Key features and details | |
Cat. No. | MABL-2846 |
Name | Anti-ROS1 mAbs |
Clone No. | AFD- ROS1-5F2 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | WB, ELISA |
Species Reactivity | Human |
Basic Information | |
Specificity | This antibody binds ROS1 kinase domain. Mutations, rearrangements, and overexpression of the ROS1 gene can all lead to the imbalance of the ROS1 kinase protein, and the abnormal ROS1 protein kinase activity activates multiple downstream oncogenic signal pathways, including PI3K/AKT/mTOR, STAT3, RAS-MAPK/ERK, VAV3 and SHP-1/2 etc. |
Alternative Name | MCF3, ROS; Proto-oncogene tyrosine-protein kinase ROS; Proto-oncogene c-Ros; Proto-oncogene c-Ros-1; Receptor tyrosine kinase c-ros oncogene 1; c-Ros receptor tyrosine kinase |
UniProt | P08922 |
Immunogen | The original antibody was generated by immunizing mice intramuscularly with purified peptide 'GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRK and immune enhancer PEI in a ratio of 1:3 and dissolved in a serum free and dual-antibody-free DMEM solution. The purified peptide is identified as a specific binding fragment of PF-06463922 (Crizotinib, Xalkori). |
Application Notes | The binding specificity of this antibody for ROS1 was determined using ELISA. This antibody was also capable of detection the ROS1 kinase domain polypeptide in a western blot assay. The original IgG2b version of this antibody was capable of binding the antigen with a high affinity and the dissociation constant reaches Kd=3.56×10-11M. The affinity measurement was done using surface plasmon resonance. This antibody showed a good inhibitory effect on hepatocellular carcinoma cells (HepG2) in a CCK-8 cytotoxicity test (CN111440241). |
Antibody First Published | |
Note on publication | |
COA Information （For reference only, actual COA shall prevail） | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |
