Key features and details | |
Cat. No. | MABL-127 |
Name | Anti-SUR1 mAbs |
Clone No. | AFD-N289/16 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | WB |
Species Reactivity | Hamster, Rat, Mouse |
Basic Information | |
Specificity | This antibody is specific for the SUR1 protein. It does not cross-react with SUR2B. SUR1 is a subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K+ channels and insulin release. |
Alternative Name | N289/16R; ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; Abcc8 |
UniProt | Q09429 |
Immunogen | This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548- 1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1. |
Application Notes | The IgG1 antibody was used for western blotting on CA1S cells (Bruin et al, 2014; PMID:24257076). Immunofluorescense was preformed with the IgG1 version of this antibody on HeLa cells (Karnik et al, 2013; PMID:24392021). The IgG1 version of this antibody was used to preform western blot on COS6m cells (Li et al, 2013; PMID:23798684). |
Antibody First Published | Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360 |
Note on publication | This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research. |
COA Information （For reference only, actual COA shall prevail） | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |
