Key features and details | |
Cat. No. | MABL-629 |
Name | Anti-Caspase-3 mAbs |
Clone No. | AFD- 4F-6 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | inhibition, WB, ELISA |
Species Reactivity | Human |
Basic Information | |
Specificity | The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA. |
Alternative Name | CASP-3; CPP-32; SCA-1; EC: 3.4.22.56; Apopain; Cysteine protease CPP32; Protein Yama |
UniProt | P42574 |
Immunogen | The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC. |
Application Notes | The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A). |
Antibody First Published | |
Note on publication | |
COA Information （For reference only, actual COA shall prevail） | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |
