Key features and details | |
Cat. No. | MABL-520 |
Name | Anti-Beta-secretase 2 mAbs |
Clone No. | AFD- 1/9 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | crystallography, SPR, IF |
Species Reactivity | Human |
Basic Information | |
Specificity | This antibody is specific for the sequence TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYEC of human Beta-secretase 2. |
Alternative Name | DRAP; Asp 1; BACE2; AEPLC; ASP21; ALP56; ASP1; CDA13; UNQ418;PRO852; Memapsin-1; Aspartyl protease 1; Aspartic-like protease 56 kDa; Beta-site APP cleaving enzyme 2; Down region aspartic protease; Theta-secretase; Membrane-associated aspartic protease 1; Beta-site amyloid precursor protein cleaving enzyme 2 |
UniProt | Q9Y5Z0 |
Immunogen | The original antibody was raised by immunizing Swiss albino mice with human Beta- secretase 2 amino acids 244 to 333. |
Application Notes | The structure of the original antibody was determined using x-ray crystallography. This antibody was used for surface plasmon resonance on Beta-secretase 2 (Banner et al., 2013; PMID:23695257). This antibody was used to stain BACE2 in immunofluorescence on pancreatic human islets (Rechsteiner et al., 2014; PMID:24905913). |
Antibody First Published | Banner et al. Mapping the conformational space accessible to BACE2 using surface mutants and cocrystals with Fab fragments, Fynomers and Xaperones Acta Crystallogr D Biol Crystallogr. 2013 Jun;69(Pt 6):1124-37. PMID:23695257 |
Note on publication | In the original paper BACE2-binding antibody Fab fragments, single-domain camelid antibody VHH fragments (Xaperones) and Fyn-kinase-derived SH3 domains (Fynomers) were used as crystallization helpers to obtain the first high-resolution structures of BACE2. |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |

