Key features and details | |
Cat. No. | MABL-3306 |
Name | Anti-ZP2 mAbs |
Clone No. | AFD- IE3 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | IP, NTRL, WB, IF, IHC |
Species Reactivity | Mouse |
Basic Information | |
Specificity | IE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These glycoproteins act as receptors for sperm and this recognition serves as a critical step of fertilisation. |
Alternative Name | Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; ZP-2; Zp2; Zp-2; Zona pellucida protein A |
UniProt | P20239 |
Immunogen | Osbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas. |
Application Notes | IE3 was shown to react with ZP2 by immunoprecipitation and immunofluorescence staining of various mouse tissue sections (East & Dean, 1984; Avella et al, 2014). IE3 was also shown to neutralise ZP2 activity in vivo by causing transient infertility in female mice. |
Antibody First Published | East & Dean. Monoclonal antibodies as probes of the distribution of ZP-2, the major sulfated glycoprotein of the murine zona pellucida. J Cell Biol. 1984 Mar;98(3):795-800. PMID:6699085 |
Note on publication | Describes the generation of five mAbs directed against the mouse zona pellucida, and the use of these mAbs in characterisation of the zona pellucida extracellular matrix. |
COA Information （For reference only, actual COA shall prevail） | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |
