Key features and details | |
Cat. No. | MABL-2546 |
Name | Anti-OPG mAbs |
Clone No. | AFD- AbAb01OPG |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | ELISA |
Species Reactivity | Human |
Basic Information | |
Specificity | This antibody is specific for the N-terminal epitope of OPG. |
Alternative Name | Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor |
UniProt | O00300 |
Immunogen | The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope(MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ). |
Application Notes | This antibody was generated as a capture antibody that binds to the N-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding detection antibody (AbAb02OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A). |
Antibody First Published | |
Note on publication | |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |

