Key features and details | |
Cat. No. | MABL-131 |
Name | Anti-SUR2B mAbs [N323B/20](MABL-131) |
Clone No. | AFD-N323B/20 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | ICC, WB, IHC |
Species Reactivity | Rat |
Basic Information | |
Specificity | This antibody is specific for the SUR2B protein and does not cross react with SUR1. SUR2B is a subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation. |
Alternative Name | N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2 |
UniProt | Q63563 |
Immunogen | This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503- 1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B. |
Application Notes | This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot. |
Antibody First Published | Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360 |
Note on publication | This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research. |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |




