Cat. No.
MABL-1659
Application
crystallography, FACS, in vitro, IP, neutralization, SPR, ELISA, FC
Isotype
Engineer antibody
Species Reactivity
Human Cytomegalovirus
Clone No.
1G2
From
Recombinant Antibody
Specificity
This antibody is specific for a surface epitope in antigenic domain 5 (AD-5), also termed Domain I (Dom I), of Human cytomegalovirus (hCMV) (strain Towne), also called Human herpesvirus 5 (HHV- 5). Dom I resides between amino acid residues 133 to 343 of the gB of hCMV strain AD169 and has the following sequence: IVAHTFKVRVYQKVLTFRRSYAYIYTTYLLGSNTEYVAPPMWEIHHINKFAQCYSSYSRVIG GTVFVAYHRDSYENKTMQLIPDDYSNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMLT ITTARSKYPYHFFATSTGDVVYISPFYNGTNRNASYFGENADKFFIFPNYTIVSDFGRPNAA PETHRLVAFLERADSVISWDIQDEKNVT. The exact epitope lies between Tyr280-Phe300, or: Y- NGTNRNASYFGENADKFFIF-P.
Alternative Names
Envelope glycoprotein B; UL55; Ab-50
UniProt
P13201
Immunogen
The original antibody was isolated from EBV transformed human peripheral blood derived B cells derived from hCMV-infected donors.
Application Notes
The original version of the antibody was used in a neutralization assay against human cytomegalovirus (hCMV). It was found to neutralize hCMV with high potency — it neutralized the virus with an IC50 of 0.1 μg/ml and an IC90 of 0.4 μg/ml (US9346874B2). The Fab version of this antibody was generated and its structure in complex with hCMV gB was explored using crystallography. It was also used in neutralization assays, surface staining of full-length gB in flow cytometry, and gB immunoprecipitation (Chandramouli et al., 2015; PMID: 26365435).
Antibody First Published
Pötzsch et al. B cell repertoire analysis identifies new antigenic domains on glycoprotein B of human cytomegalovirus which are target of neutralizing antibodies. PLoS Pathog. 2011 Aug;7(8):e1002172. doi: 10.1371/journal.ppat.1002172. PMID:21852946
Note on publication
The original publication investigates the B-cell response to glycoprotein B (gB) of human cytomegalovirus (HCMV) in healthy infected individuals, identifying new antigenic domains (AD-4 and AD-5) targeted by neutralizing antibodies, which could inform vaccine design and antibody therapies.
Size
100 μg Purified antibody.
Concentration
1 mg/ml.
Purification
Protein A affinity purified
Buffer
PBS with 0.02% Proclin 300.
Storage Recommendation
Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C.



